High Quality Enfuvirtide CAS NO.159519-65-0
- FOB Price: USD: 1.00-1.00 /Gram Get Latest Price
- Min.Order: 1 Gram
- Payment Terms: L/C,D/A,D/P,T/T,MoneyGram
- Available Specifications:
1(1-2)Gram
- Product Details
Keywords
- 159519-65-0
- Enfuvirtide
- Enfuvirtide Price
Quick Details
- ProName: High Quality Enfuvirtide
- CasNo: 159519-65-0
- Molecular Formula: C204H301N51O64
- Appearance: White powder
- Application: pharmaceutical intermediates
- DeliveryTime: Qingdao Port
- PackAge: 1kg or 25Kg drum
- Port: QIngdao Port
- ProductionCapacity: 3000 Metric Ton/Year
- Purity: 98% HPLC
- Storage: Store in dry, dark and ventilated plac...
- Transportation: By air or by sea. Prompt delivery
- LimitNum: 1 Gram
- Moisture Content: See data sheet
- Samples: Available
Superiority
We promise our customer following items
1.Reasonable price:
2.Low moq:No worry about the low moq, our moq is 1 gram or lower.
3.Good and efficient service,Fast Delivery
4.Super-good quality
Details
Name:Enfuvirtide Acetate
Cas No: 159519-65-0
Formular: C204H301N51O64
Molecular:4491.87
Sequence: AC-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Pentafuside, Fuzeon, DP178, T-20, T 20 (peptide), Dp 178
Enfuvirtide is a short polypeptide with activity against human immunodeficiency virus (HIV). Enfuvirtide binds to the first heptad-repeat (HR1) in the gp41 viral envelope glycoprotein, thereby preventing conformational changes required for fusion of viral and cellular membranes and preventing the virus from entering a host cell.